PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0116s0046.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 266aa    MW: 31210.5 Da    PI: 6.2672
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0116s0046.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B360.72.5e-19999199
                         EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                   B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91
                         ffkv      ++ +++ lp+ f   + +g+k ++   +l  +sg+ W+v+l  + + ++  +t+GWk+Fvk+n++++gDf+vF++d+ +ef 
  Kalax.0116s0046.1.p  9 FFKVY--LPEFSADQMKLPRLFKY-YmEGVKSGP--AKLIGLSGEAWRVRL--EHNEEGLCFTEGWKDFVKDNEVETGDFLVFSYDEGMEF- 92
                         67777..77899999******964.359998777..9999***********..9*******************************987888. PP

                         .EEEEE-S CS
                   B3 92 lvvkvfrk 99
                          +v+++++
  Kalax.0116s0046.1.p 93 -RVTIYDH 99
                         .9988876 PP

2B373.62.3e-231852631395
                          TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                   B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                           +++++p +f++eh+++ +++ +++l++e +++W+vk+   k++++yv+t+GW +Fv++n+LkegD+++F+l++  + el+v+
  Kalax.0116s0046.1.p 185 ARNMCIPSTFISEHDLSYKKNEKVRLQNEGNKRWSVKV--VKHGCTYVFTAGWPQFVRDNELKEGDICIFELQS--RLELRVH 263
                          3569**********777778889***************..*******************************865..5555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.94E-233102IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.4E-224100IPR015300DNA-binding pseudobarrel domain
CDDcd100175.47E-19798No hitNo description
PROSITE profilePS5086313.9587100IPR003340B3 DNA binding domain
SMARTSM010197.1E-179100IPR003340B3 DNA binding domain
PfamPF023621.2E-16999IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-23166264IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.3E-22168264IPR015300DNA-binding pseudobarrel domain
CDDcd100173.83E-20171263No hitNo description
SMARTSM010192.6E-12172266IPR003340B3 DNA binding domain
PROSITE profilePS5086314.565173266IPR003340B3 DNA binding domain
PfamPF023626.2E-20181263IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MAEDRWPEFF KVYLPEFSAD QMKLPRLFKY YMEGVKSGPA KLIGLSGEAW RVRLEHNEEG  60
LCFTEGWKDF VKDNEVETGD FLVFSYDEGM EFRVTIYDHT WCEKEAALRA ICSQGLRECE  120
EQNEQQNERE KPVGMAQKCG SLKRKRSGQG LSIPEEMELV EVAESFWSTY PFFVVRLKGY  180
NVRGARNMCI PSTFISEHDL SYKKNEKVRL QNEGNKRWSV KVVKHGCTYV FTAGWPQFVR  240
DNELKEGDIC IFELQSRLEL RVHHRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1yel_A3e-1411023104At1g16640
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.13e-20B3 family protein